PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00031892-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 81aa    MW: 9304.95 Da    PI: 10.6628
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00031892-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.49.5e-29958150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        krien++nrqvt+skRr+g++KKA+EL vLCda+v++i++ss+ kl++y 
  WALNUT_00031892-RA  9 KRIENETNRQVTYSKRRKGLFKKAHELTVLCDAKVSLIMISSNKKLRDYV 58
                        79**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.319161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.89E-30170IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-36160IPR002100Transcription factor, MADS-box
CDDcd002654.78E-33266No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-27323IPR002100Transcription factor, MADS-box
PfamPF003194.1E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MARGKIQIKR IENETNRQVT YSKRRKGLFK KAHELTVLCD AKVSLIMISS NKKLRDYVSP  60
STTYVISFFL ILCLSSSAYT N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A5e-17266165Myocyte-specific enhancer factor 2A
3mu6_B5e-17266165Myocyte-specific enhancer factor 2A
3mu6_C5e-17266165Myocyte-specific enhancer factor 2A
3mu6_D5e-17266165Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3130891e-82AJ313089.1 Juglans regia partial mRNA for putative apetala 3 protein (ap3 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510472.21e-32PREDICTED: floral homeotic protein DEFICIENS
SwissprotP237066e-33DEFA_ANTMA; Floral homeotic protein DEFICIENS
SwissprotP356326e-33AP3_ARATH; Floral homeotic protein APETALA 3
TrEMBLS8DEG02e-33S8DEG0_9LAMI; Uncharacterized protein (Fragment)
STRINGfgenesh2_kg.5__1825__AT3G54340.11e-30(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27353375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.14e-34MIKC_MADS family protein